PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 216aa    MW: 23707.6 Da    PI: 10.2041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1580genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.2e-15146196353
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                   ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L++eN +L+ + e++ 
  Gh_A05G1580 146 NDRRRKRMMKNRESAARSRARKQAYTSELELEVAHLQEENAKLRRQQEKIL 196
                  589*****************************************8776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-13144208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.53146195IPR004827Basic-leucine zipper domain
PfamPF001709.7E-13147195IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-14148195No hitNo description
SuperFamilySSF579591.63E-11148195No hitNo description
PROSITE patternPS000360151166IPR004827Basic-leucine zipper domain
CDDcd147075.05E-20158198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEEVWKDISL ASLSDHPVDS ILSTRTKNPN FPSMILLDFL ATPINKEPPT PRTSGVSSND  60
TSSTEGPAPF VPGTILSLKS GFGSACRCTE SADPIRPNLE VNARAGVPAA PSFSSSHNSG  120
FRGFSSPEAF PSFCTKRAPE SSENSNDRRR KRMMKNRESA ARSRARKQAY TSELELEVAH  180
LQEENAKLRR QQEKILAARD QVPKKNTLSR TSTAPF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441842.11e-145PREDICTED: protein FD-like, partial
TrEMBLA0A0D2TSJ51e-146A0A0D2TSJ5_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.16e-41bZIP family protein